PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G058600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 308aa    MW: 32501.1 Da    PI: 9.6861
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G058600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.62.7e-401182171100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++C+++pyf   +p+kfa+vhk+FGasnv+k+l +++e++r d+++slvyeA+ r+rdPvyG++g il+lqqq++ 
  Sobic.009G058600.2.p 118 PCAACKLLRRRCAQECPFSPYFSPLEPHKFAAVHKVFGASNVSKMLLEVHESQRADTANSLVYEANLRLRDPVYGCMGAILTLQQQVQA 206
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+aela++++e
  Sobic.009G058600.2.p 207 LEAELATVRAE 217
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.237117218IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-40118215IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MVQEHPYISC STISCQHRRI LLILLCQAHT LKRHKHRKPR SHLFQSTSIP FLSPQAIFFM  60
STASASEWPD HDELGKKIKR ESAAERMTAA ARRSCSSPVG AGAVAGAGPG SALNTITPCA  120
ACKLLRRRCA QECPFSPYFS PLEPHKFAAV HKVFGASNVS KMLLEVHESQ RADTANSLVY  180
EANLRLRDPV YGCMGAILTL QQQVQALEAE LATVRAEIVR HRCRPAAVLP SSHASQLLAA  240
SAAGRGLHAG SRPSVGARAA TLAAAAAAAA VGPVASSSSS SAVYAAAAAS SSTDYSSITN  300
ENVPYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-144FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440676.11e-177hypothetical protein SORBIDRAFT_09g004940
SwissprotQ9AT613e-69LBD13_ARATH; LOB domain-containing protein 13
TrEMBLC5Z1131e-177C5Z113_SORBI; Putative uncharacterized protein Sb09g004940
STRINGSb09g004940.11e-176(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.19e-58LOB domain-containing protein 15